PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.D01819.1.p
Common NameEUGRSUZ_D01819
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 315aa    MW: 35098.4 Da    PI: 5.5719
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.D01819.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.4e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg W++eEde+l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl
  Eucgr.D01819.1.p 14 RGLWSPEEDEKLIRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                      788*******************************************97 PP

2Myb_DNA-binding53.36.5e-1767111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rgr+T+eE++l++ ++   G++ W+ Ia++++ gRt++++k++w+++
  Eucgr.D01819.1.p  67 RGRFTPEEEKLIISLHGVVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                       89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-25664IPR009057Homeodomain-like
PROSITE profilePS5129417.264961IPR017930Myb domain
SuperFamilySSF466894.12E-3011108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002492.3E-151461IPR001005SANT/Myb domain
CDDcd001671.90E-111761No hitNo description
PROSITE profilePS5129425.71262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-2565116IPR009057Homeodomain-like
SMARTSM007171.9E-1666114IPR001005SANT/Myb domain
PfamPF002491.5E-1567111IPR001005SANT/Myb domain
CDDcd001676.14E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIT THGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF TPEEEKLIIS LHGVVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKPS  120
PASLTNVPPS TSSEHSLLSN SSNQLSCAMP DLMAAKMPVQ ETLFSSPCPL FMFDTASLEG  180
LAESNEQQEL FTEAVTVNSA GTWNLNHQQF HTTLLPPPPP YTSGSADANY LPPLIENVEN  240
MLNIGAQSSN IDEEGDRIAL ECFQRQELNE WVESHQCPNF LLWDNVEGPF GGEDIVPASS  300
TAGASTMSSF PSSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-27141167108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.D01819.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010054774.10.0PREDICTED: transcription factor MYB51
TrEMBLA0A059CHU20.0A0A059CHU2_EUCGR; Uncharacterized protein
STRINGPOPTR_0003s13190.11e-158(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM87602539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.12e-99myb domain protein 103